PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn337851
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 299aa    MW: 34146.1 Da    PI: 8.4658
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn337851genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.32.7e-3166119255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtp+LH +F++a+++LGG+e+AtPk + ++m+vkgLt++hvkSHLQ+YR+
  Achn337851  66 PRLRWTPDLHLCFLQAIDRLGGQERATPKLVQQVMNVKGLTIAHVKSHLQMYRS 119
                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.07762122IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.8E-2962120IPR009057Homeodomain-like
SuperFamilySSF466891.09E-1465120IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-2466121IPR006447Myb domain, plants
PfamPF002493.2E-867118IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MKEIGDIEGS KANPLDMNIE DEEGCDHHDD ENKPKTSASS SNSVADEEEK KAISSGVRQY  60
IRSKLPRLRW TPDLHLCFLQ AIDRLGGQER ATPKLVQQVM NVKGLTIAHV KSHLQMYRSK  120
KIDNQGQVIN GRRYANGRAD GFVDNFWQPF VLHQKLRSYK DVPWIGHENW ISSSCIIDNT  180
KGAFYVDNSK RFYQSQYQHS RQWHGNGGEN VNYFFNNSFI PNTSWSTNGG HKCHTLKRRA  240
EDNDLIDLNL SLSVKKSRQE EAKKTIWDDE VDSNLCLSLF SRAKKQNLAI DLNFPSTS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278456.16e-67PREDICTED: uncharacterized protein LOC100246669
TrEMBLB9HNC01e-66B9HNC0_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0009s07890.14e-66(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43822141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-42G2-like family protein